PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00342g12001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 198aa    MW: 21988.5 Da    PI: 7.4083
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00342g12001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.26.6e-5525120297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               +e d+flPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk y
  Peinf101Scf00342g12001.1  25 KELDKFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKGY 109
                               788********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l+kyre+egek
  Peinf101Scf00342g12001.1 110 LNKYRETEGEK 120
                               *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-5221137IPR009072Histone-fold
SuperFamilySSF471133.42E-4028148IPR009072Histone-fold
PfamPF008082.2E-273094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.2E-195876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.2E-197795No hitNo description
PRINTSPR006153.2E-1996114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTGKRSQNSP VGSPLSGNVS DNSSKELDKF LPIANVSRIM KKSLPANAKI SKEAKETVQE  60
CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMTTLGFE NYVGPLKGYL NKYRETEGEK  120
NIMARNEEPS EVPTTSNSAN TYDHVTKFSL ARPELIRSFN NGNFSEMNNL KSYGDNYGRV  180
IGYGENVTSA ANLHGVEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B1e-4525115292Transcription factor HapC (Eurofung)
4g91_B1e-4525115292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-117HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787043.11e-114PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X1
RefseqXP_009787044.11e-114PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X2
RefseqXP_016490537.11e-114PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233103e-61NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLM1DVD61e-103M1DVD6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000950091e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-62nuclear factor Y, subunit B3